PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g083190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 358aa    MW: 40285.7 Da    PI: 10.0614
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g083190.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind45.13.8e-14852141125
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki.....rernlalsekkaav...........aerd........maflqrdkalaern 71 
                     m++dg ++rn+gyyep+ +++ nlg+ql+ s+ +r++k+     +++n+++++++  +            +rd        m++    ++l++  
  Csa05g083190.1  85 MNEDGLNNRNWGYYEPS-QFRPNLGFQLIPSVIDRNEKPfivspQNQNQNFITPNVLYrgggsssslmsFPRDytasdapfMSY----SWLNQ-- 172
                     99**************9.************************************999966666666655444477776666666....88888.. PP

       GAGA_bind  72 kalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsave 125
                         +rd+k++++++ + s         + +++t+ + +  ql +p++ed++ +
  Csa05g083190.1 173 ----HRDSKFFSNVPSNPS--------NHLVPETSRMTQPMQLLQPEVEDESLK 214
                     ....9*********96554........334455555544444455666666555 PP

2GAGA_bind2701.2e-82214357159301
       GAGA_bind 159 pkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrg 252
                     ++++++ ++k k+ek+ k+ ++++++ ers   +ksi++v+ngvs+D++ lPvPvCsCtG+++qCY+WG+GGWqSaCCtt++S+yPLP+s+krrg
  Csa05g083190.1 214 KRKHQRGAPKTKKEKKLKDDNMPRVQrERSPFFRKSIEMVINGVSMDIGCLPVPVCSCTGMPQQCYRWGCGGWQSACCTTNVSMYPLPISAKRRG 308
                     233333356666666777778888877999***************************************************************** PP

       GAGA_bind 253 aRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     aRiagrKmSqgaf+k+LekL+a+G+d+s p+DLk+hWAkHGtnkfvtir
  Csa05g083190.1 309 ARIAGRKMSQGAFRKVLEKLSADGFDFSIPIDLKSHWAKHGTNKFVTIR 357
                     ************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.7E-14185357IPR010409GAGA-binding transcriptional activator
PfamPF062176.8E-785208IPR010409GAGA-binding transcriptional activator
PfamPF062171.1E-75215357IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MEFRVWVLCR QMELSILLGF VVAKKKCISS FEAVIFACLA VIALPSQPLS FLSPLTVKDA  60
AVVVVTPRSV FVSSLASVLF SYIMMNEDGL NNRNWGYYEP SQFRPNLGFQ LIPSVIDRNE  120
KPFIVSPQNQ NQNFITPNVL YRGGGSSSSL MSFPRDYTAS DAPFMSYSWL NQHRDSKFFS  180
NVPSNPSNHL VPETSRMTQP MQLLQPEVED ESLKRKHQRG APKTKKEKKL KDDNMPRVQR  240
ERSPFFRKSI EMVINGVSMD IGCLPVPVCS CTGMPQQCYR WGCGGWQSAC CTTNVSMYPL  300
PISAKRRGAR IAGRKMSQGA FRKVLEKLSA DGFDFSIPID LKSHWAKHGT NKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0125631e-135AC012563.7 Arabidopsis thaliana chromosome 1 BAC T23K23 genomic sequence, complete sequence.
GenBankAY3805691e-135AY380569.1 Arabidopsis thaliana basic pentacysteine 3 (BPC3) mRNA, complete cds.
GenBankBT0221171e-135BT022117.1 Arabidopsis thaliana At1g68120 mRNA, complete cds.
GenBankCP0026841e-135CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010511770.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like
RefseqXP_010511771.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like
RefseqXP_010511772.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like
SwissprotQ9C9X61e-157BPC3_ARATH; Protein BASIC PENTACYSTEINE3
TrEMBLR0GFA21e-171R0GFA2_9BRAS; Uncharacterized protein
STRINGAT1G68120.11e-156(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153471518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.11e-148basic pentacysteine 3